ELF4 4 (444  TTT@@Lov hhhDDPtdxxx,,QtdRtd/lib/ld-linux.so.2GNUGNU١dr2?(*Bz%>!8$50 <72*"64(-'1/=9.,&3  ; + #) :%:+":;)K8gUaD)(fWm  6>7P |bg#.=W Fo0`^0{#įlibz.so.1__gmon_start___Jv_RegisterClassesgzdopengzclosedeflatezlibCompileFlagsgzopen64gzreadinflateinflateInit_gzseek64inflateEnddeflateEnddeflateInit_libc.so.6_IO_stdin_usedstrcpy__rawmemchrgmtime_rsetlocalestrrchrperror__isoc99_sscanftime__stack_chk_failunlinkstdingetpidstrspnfgetsstrlensigemptysetmemsetstrstrstrcspnmemcmp__fprintf_chkstdoutmemcpyfclosemalloctimegm__ctype_b_locstderrsigactionlseek64strchrqsort__strcpy_chk__sprintf_chkmemmovefopen64accessstrcmp__libc_start_mainwritefree__cxa_atexitZLIB_1.2.0.2GLIBC_2.4GLIBC_2.3GLIBC_2.7GLIBC_2.3.4GLIBC_2.1GLIBC_2.1.3GLIBC_2.0  2 5ii Bii Lii Vti `ii lsi vii  <į=:   $ ( , 048<@DHLPTX\`dhlptx |!"#$%&'()*+,-./012Ġ3Ƞ4̠5Р6Ԡ7ؠ8ܠ9US[t1SX[5%%h%h%h% h%h %h(%h0%h8p% h@`%$hHP%(hP@%,hX0%0h` %4hh%8hp%<hx%@h%Dh%Hh%Lh%Ph%Th%Xh%\hp%`h`%dhP%hh@%lh0%ph %th%xh%|h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%Ġh%Ƞh%̠h%Рh%Ԡh%ؠh%ܠhp1^PTRhhQVhUS=u? 9s9r[]Ít&'Utt $ÐUWVSu3B09s 9r[^_]Ðt&)шu뱍t&UWVSÃ,҉M ډu209s9rE,[^_]ÐMύv$t$D$ D$ lI$t$D$ D$ GÉ u}xf-}ۃމ}듍t&'UVS x[^]Ít&SKyt&x҃Ӊ[42^] U |$$t$ x+u$t$|$]ÐJR~@yx҃Ӄ42t뢍t&UWVSE EɉExEEU[^_]zr1ۋME؀EyFt&U܉ЉU}eEE؉UUM]U܉E>xE܁ljEE}EE؉U܋UڃUUEE2U[^_]Ív'UWVS$EEȄMxFEE؃uU܋E$[^_]Ë]܋M؃$ȉ[^_]Ít&J]1Mz1Ҹ@~yUMEЉUfUԉЉU}eEEЉUU]uUԉE9xEЋUԉMʋM؋] M؃2Éу$؉[^_]Í&'U8}ǡ]utI1t$ <\$Ή؉$T$E]u}]U(]}ǸutH1t$ <\$Ή؉$T$#E]u}]Ít&'UE M9 ]ÐUWVS,Up 5w5wt9X;| PU9x E; == t0 t1VU;M~!1;|1҃,[^_]Ít& 1EUЉE̍v9]|!q9u}y9}}|.Q 9UU|.v}ЅtYUЋRUЋuЅtY}ЋfA 9EE|(})+}ԉ}+}ԉUỦE)9U}-}ЃEufIMЋuЅuvU܃,[^_]9EwȐt&UWVS E𡸰UMpMb x 5| = )‰i)Ѓ=ȺMb)‰i)Ѓ=Mb)‰i)Ѓ=Mb)‰i)Ѓtd=EEE0E8 [^_]Ðt&EE [^_]f~@t&~P랍&~P^t&~ t&~t&~t&~Kt&~t&UWVSӃKgfffC.))ƍF0gfff)ƍ)gfff0K)Ǎ)ƍF0Cgfff))ǍG0gfffCgfff)ƍ)gfff0K))ƍF0Cgfff)ƍ)0KK))ƅҍF0ֈAE9s19rE[^_]Í&-Zv U=rtarBv,BRt u=rw ]Í& v r]Ív'UWVSȱEı =б]E9)+E#Ep]1Ӊ]]3] ]9|=]9]s5t&9EsQ)+E#EX01׉}}1 }tF9}}] 뀍&;uv9Et&r`[^_]Í`[^_]UWVSÃ$D$D$$ ))9D)8t'&8uu1[^_]ft:r[^_]ÍU t$A  tt$ Ð&Ut$t$t$ Ut$aÍ'Uرt$1رܱt$ܱfUSu ؋8J$ۉu[]Ð&U4 t&$ 0 4 É'UWVSÃ,5رUE~qt&~b|$$uU+}=ܱt/MWt&z9߈tuL ,[^_]Í&UWVSE-8DGu.5wt[^_]Í&12&DOt.t*ۃDCt.u1t& HqE[^_]fEdU]Éu}u&] eVt&u7uOǍvرEE ft uudU:Eu:B:Fu.B:Gu"B:HuC&uI=u[ر7Ɖرǀ@idرǀnameƀft'= u<  1,[^_]1,[^_]ËuNt$uS5&]D$D$$;$$ررңܱt9t5$E- uX_1ME'U5t>5="t(-"D$D$"$O5"5D$ D$D$$x5"15"f҉xD$ D$D$$[ÍUWVS, =r]xXu&r3tx0SEU1Ґ9KuEUp+p 9E䍴&πσ9SuE St$@ $D$ srBv,ZBt u=rw ,[^_]Ð  xޡD$TD$$,[^_]ËSFSr] B R)J rpU J;Jr4$$xD$D$$VÍt&JÍ&'UWVSÃ=r;qr=00xD$D$$ [^_]fP=H r90V29rcP  t' & t 9u+P P HPx[^_]Ít&,,\D$D$$&:5@ =H 5D 0L&r04&'U(u]  Y Q)ڍr9G 4ɉ 4x(2T$D$ D$$D$$]u]fA]u]Ð&USÃ$=~*D$H~D$hD$D$ $,H~$[]Ð&UWVS,  MIuY 9^s8LLxD$D$$,[^_]fÉƃ1 t%ˀ]׉KÃ1 u܈uN,[^_]ÐUWVS9w u- D$UD$ $gU İ멐=9)߃1 n18+f8  L3989w u- D$UD$ $лU İfEe3|[^_]Ë=)߃xɋ n18)t&8  L398x9w u- D$UD$ $U İ랍]xh= nu8 8xA9ru- D$D$ $誺 İ믍&5= n1ۡ8+v8   9ߣ89w u- D$UD$ $U İ뛍v- D$D$ $ İt&M1ҍu vEE蔻UWVS\E࡬U܅u ;1\[^_]Ðt&u85@ 4EԡuЉE1Eč9M<;]s| 43%<9}C9U:E}@u E܉ u9MԉEyE>  E1jfY;};u=@$ M u܉MuK  yQYyvx҃щ42Ut&  (5E1MЉu؉E̍v9U$;]s| V3$9}[9MRE}@E u܉ E9UԉuyE=@}҉xc 40 t޺ t tD$D$@T$ D$8D$$$\@[^_]Í&MKsyẼMxEɃM5$&JRyẼxE֍<:QnvUSsy'M̋EċM؃xM؋M̉E҃U؉5<t&QqyEăxEэN 4<:.vSKyt&x҃Ӊ <:t&\u؉L$|$ D$t$D$$O1+MT$|$ D$L$fMt$|$ D$L$fUWVSx=`v|t&hPx|@ M|t H LHL|09٣ DM9MPvL )ˉ\$L$$辵V|Nj B z9É AAADЅ=~)T$ D$D$$藲|$踲|$諳 |x|=`v|AAAl~#v ~$9[^_]É-)PL$$D$H| + P  f|ǀDP )=0~0$D$D$|UWVSlleE1h $0D$\$ݲ1\ Džtt&t \ t䋕t<p78pu,ptx1҉ fti\D8tƉЉtOt4:pu(pt.1҉t!\D8tÉG&D$x$\ D$D$D$ $įD$$D$PD$ $tD$ $tx< ut&< tD$&D$$      ` J$ 7\ \ uD$}D$D$ $աt&\ D$D$D$ $裡\ D$D$|D$ $vįD$4$D$ݡD$ 4$荡tD$ 4$vt t&.D$,4$Uu}D$4$臣|\ D$D$lD$ $迠įD$<$D$&D$ <$֠tD$ <$迠t .D$,<$蝠u}D$<$Ϣ|\ D$D$tD$ $įD$D$E$kUD$ $tED$ $t t&.UD$,$ڟu}$ED$$ |\ D$D$dD$ $Aįl$D$D$袟lD$ $LtlD$ $/t .lD$,$u〽ltRlD$$4lu2\ D$D$̂D$ $m\ D$D$D$ $;f\ D$D$D$ $\ D$D$D$ $֝įD$4$D$=D$ 4$tD$ 4$֝tD$$D$4$)93)8.u,vtN8t߉Ät4\ D$ D$D$$D$4$褟uFD$4$ u2\ D$D$̂D$ $虜\ ܂g\ D$ D$D$$V\ D$D$\D$ $)įD$$D$萜D$ $@tD$ $)tx u؍t& t123\ "\ D$ D$D$$l\ D$D$D$ $?įD$$` D$袛D$ $` NtD$ $` 3tD$$XD$$` B` 94)8.u-8tމÉt` 赩D$$` ` uJD$$` tu2\ D$D$̂D$ $I\ ܂`DžDDžtDž\\ D$D$̂D$ $袙DžTDžP  yF\ D$D$LD$ $I$]D$D$+T D$ ¡T$$ \ D$D$DD$ $D$ D$D$$軘\ 9H .osmC=.pbfCf.o5cCI.o5mC,.oscCtt  Tt.  D$$x=D  DžDDžtDž\DžDDžtDž\ƙ\DžPU01'UWVS Džh9ft!p!p;lYE "EE輛U;l-p119#<"]<t&:<<b̨̨x@|$BD$BD$BD$D$D$D$ $E4;]ȨȨxD$D$$ʕ4;;|x|04<֚8;s8;s+;s;s;+9@1v Ĩ҉Ĩx,PT$D$D$D$ $谔E  +E9lx;th\%tE< 9 % | * |҉|x/PT$D$D$D$ $Eˉʃd%fL$ D$\D$$術 t&x1tpl|xtpc[^_]Í&t и 9"09w |D9"8"xHSxIP <3Džht)؃u8 &pp 5 릍t&"VV5)=)99#EEEEEEEEEED$8D$$HáHHx%\$ D$pD$$tt&t&\\xD$@D$$*77EE U4;5l&5p9\$ D$\D$$Qhht&UE2M9V% U `UE`04vUEҎM9& U|UE袎M9( UUErM9`( Ux EE( )xD$D$$dxEE xD$XD$$蒈x<EEhdX҉x!D$ D$D$$#&EEM;t_% p lxfEE躌U ; tb% lf9: x/BD$D$pD$D$ $JU ى؃tWt&tf\$ D$\D$$[^_]Ívɉy f>xuU l!ɉy f>x֍vɉy f8xX40묐BEBU;l2 <; $n‰ <E`t&ɉy f?xwy&>xHXyt& xȍC41,fBJyt&xQU &xD$D$$2SSۉy f:xUEt9xxxD$ D$$*t&ۉy f:xJz&ۉy f:x[UEZM9V T@UXt&UE"U 9ˉp  dpSx,BD$D$D$D$ $裃EvU9 <(w$`jUEjM9 L UPt&UE2M9 4U8t&UE04&UE҇M9> <U@}t&p Ppyvx҃щ5p&VNyt&x֍q5<:t&=|)Ɖ_tO p+ptO_Gt&9/ PȍP t&|L )Ӊ\$T$$ |B z9ÉBBB&M9u $U(`&d]fUE蚅UExt&UE_Xt&UE?PT&UEHLo&UE@Mt&pEJRy&x֍Q膄ƍ; ddx!T$ D$D$$5$kBEB{U:9‰E䣌]t&BEBU:9‰E䣔t&BEBCU:9E‰E䣜t&BEB+U:9>‰E䣤t&BEBSU:9‰E䣬]t&BEBU:92‰E䣴t&$kBEBCUU_&BEBUxU,t&BEBUXUt&B1EJUPU5Tt&B1EJUHU5Lt&BEBU@U\t&]~ۉy f:xzZy&;xS BJyt&xQU<8&BJyt&xQU<8&BJyt&xQU<8J&BJyt&xQU<8&BJyt&xQU<8&BJyt&xQU<8r&uU}EED$$Y{^MÉ $yxٸXJDž\Z1҄LX\04&4؃Љll0ډp0t4pt04x\LXۉ㋝X\փMXvBJyt&x‰M&BJyt&x‰M:&BJyt&x‰M"&BJyt&x‰M &؃PJDžTZ1҄LPT04&ڋ40ډp0t4pt04xTLPۉ㋝PTփMt&Hd`U&<- lEdpUy&:xU%t&y t&:xބy&:xB뵄y:xUEy :xBfy t&:x뾅 ɐy:fxzBy t&8xP#r00xD$`D$$uyt&:fxzBy t&8xP @tt!xt;  }@pt!xt;T  5l҉lx7X@D$¡T$ D$$mt)PT$ $D$v |+P|ǀDP )=0~0$D$D$rt]$sM)˃<1&9y;p==xt< v 2@@xD$D$$"spEH@Hp fpE@`t ]vBJyt&xQ<8 p0498<HLPTXx\E;;|gt& `ɉ `x(T$ D$4D$$Lq𣼰1kBJyxQP҉Px'D$ D$ D$$p5t$D$ D$D$|PD$ $px%D$ @D$HD$$-px!\$ D$ D$$oQ=ttxD$<D$$op҉px,PT$D$dD$D$ $>o1EtuDždDž`9<<"<*H < x/EPT$D$D$D$ $n]t9pxD$\D$$5n<<<H{8]r]É]pX҉Xx$D$D$D$ $mTTx$D$D$D$ $`mDDx+\$pD$D$$t$ mzL҉Lx%D$ |$D$@D$$l.XXLLx!|$ D$ D$$FlHHx!|$ D$@D$$ljDDx!|$ D$tD$$k$<<x!|$ D$D$$tk88z|$ D$ D$$*kT@@x!|$ D$D$$j]h҉hx$D$D$D$ $j\҉\x$D$dD$D$ $]j҉x!D$ D$D$$j44d҉dx>D$0D$D$T$4D$ T$$ix\//`҉`x>D$0D$D$T$4D$ T$$2ix\N҉x!D$ D$D$$h22OX҉Xx!D$ D$tD$$h66<w<{&i҉x!D$ D$D$$/hdd[[{;]m]`dm{]m]N]lc U_<x,BD$D$|D$D$ $[g̨ U9K9<v<f}< uU nD$dD$ $T$肳 뗃UmWD$dD$ $T$G YUm|  cD$dD$ $T$ UIm| ] cD$dD$ $T$蹲 ]kM˃hpD$D$$ejD$ D$$neD$D$$NeN ph]]}jU䉅pBD$ D$$DdDu"B Z 1<]11ۉ `dp]҉x!D$ D$hD$$dllD҉x!D$ D$D$$doo҉x!D$ D$D$$Jd ҉x!D$ D$LD$$d lШ҉Шx!D$ D$XD$$c$(҉(x!D$ D$D$$rcP҉Px!D$ D$D$$*c҉x!D$ D$D$$b LԨ҉Ԩx!D$ D$(D$$b҉x!D$ D$D$$Rb҉x!D$ D$D$$ btxD$D$$a2T҉Tx!D$ D$D$$aب҉بx!D$ D$D$$az$҉$x!D$ D$D$$`2,҉,x!D$ D$D$$`Dž` ҉ x!D$ D$8D$$)`mmxD$D$$_eeQDžd.ܨܨxD$D$$_n`uBxD$D$$5_dxD$D$$^P=`DJ hJ DH~J lJ DHfJ XJ DHN{-DKDH5KDH&{-KDH K DH{ TK DHK DH{ :KDHKDH{:KDHKDH{Z|EXihD(lkdk ЉECSk ECS k EC S k ECSk ESC]k E$]UÉKf>5҉x!D$ D$PD$$\1hxpx5\$h2v2D$ D$D$$[f`@bHLbPTaX ax;xsW T;HO`4h҉hx>D$0D$tD$T$4D$ T$$Zx\K&UWVS\|SC0S45]ЉEȡỦEt;E9slPUyw xV<8}ȍvEE1ƒ9\[^_]ÍvPHy]fx]ЍA<:l& M1Et΃]> uvu߀~eu~ru~suހ~iu؀~ofuЀ~nuʀ~=t&uF<'t<"uU~ WN UًDXt]1QЀ dk 㐍E8[C1+}@E~}Ћ}ԋu}ԍzuЉ}r1҉yjuԉ]]ЉEUfUЉUċ}eEЋEUԋU]uԃUE9x]ЋEU]uԉMā׋MEЍUԃMM։ȉ UE |dq`q04A@QA1}UrEC1t&UWVS|eE1=x`v||`v|d`v|t&|h9x|t߃zuً|t H LHL|09ى D9P‰  |) P \$D$$uV1|EuM}r z9ÉBBByv:֋=9}>u~u~uF<Rf>% qݍ1oxoG&1axa~& ;MMDžtDžpEE#&w m-tڸt)t& 8tډ@nuv@nt qbg]€ mm,dbٸmވUtt&8t߉ٸMމ v8t߉Eb1LKLE}G -ȈE%.mٸމtg&8t߉޸\ t&8t׉ʉc1}.munٸމ 8t߉ٸeމ v8t߉1}.ָ]@E]388t@xhˉ8Z=5wptMUxt& t&<Z}v};=,}=,E;(}(p;$~$t; ! -mOUmzؾ v8t׉‰ؾS t&8t׉„ S HE-UgЉE}Dw<.E5wE@n},u,t&€@ntvǁBC <'t<"2aGS DP\;X 3f1]@2t&UDzt+t'4tpt<.u1f Hqu]@45wuM;vCKEt&Q-MCvP_409;Eʄ҉M E$ UEhlhl5= u8H@n]EvȐdq`qSC>y&>xCSEUFEЄUENUEx|x|EUEUC Sڅ sH@yfxƍA~(&1ɫ|ڃ9^dq`q04C@SC/=d|~  3t1 p   =3--UЉEuDNu<.E5w1]@4UDZt)t%tXt<.u1=Hqu]@45wu'MPHy&xЍA42dUEƉ׉x|cUMpt, ($5 ׉}≮ ̸  |@1WUs-\-UHC{E@}9=,~=,U9(~(95$}5$9  ~)PL$T$$gB|P+EP$L$)ȉD$)B|+PF~<*<V<U9}=~)|@D$D$D$ $=?|5C$ 8JNA=ǀ8Jǀ8J8J C MUDž\~X\X|Vx@Uv1҉M]|x@Dt&DЉU}@E@UD]uD@9xx@D]|M׋M拵xƋ|Ex׃|x|׉x||ǀDP )=0C$D$D$=EsuB}} $׏!|ǀDP )=0D$D$$_= ȉ]H@~@yt&xEE(ЉEH@~@yt&xE`YAI~@yt&xɃE41A~q@y&xNEEoЉEeUE։hl]Ɖ:W\$ D$ D$$1;0?0t&UHDžTTM~PHPE@EyH]]UȃЉUMeʉEEUUu}EU x]ɉMEeMEEʉUUMhlhlщhl<=ht[=  5 ';5,}5,; (} (;$~$; ~ d`  AQyx40~^ڸ0tF 8tމÉt*6 &t8t|5C$ 8J ;=ǀ8Jǀ8J8Jt$_C Umܬ҉ܬ|@D$D$D$ $<8EPF<t&<f-ZÉ1J=5wtMUm5, ($ -e3ָnEn@<88@@3ԋ҉PD$lD$$71,҉gD$lD$$61C9$҉$x)D$D$$T2  AqP9((x$D$D$$2&5r ;5qj00x#D$D$$15r 9=q00xD$D$$n15r 95q`00xD$D$$"15 ~V )ׁ5 44x,2|$D$ D$$D$$0D$$D$$@|914      @50 8 re;5q00xD$D$$0X[X J ܸ B)=4҉4x,2D$D$ D$$D$$/=:X J  B)=4҉4x,2D$D$ D$$D$$/W J  B)=e4҉4x,2D$D$ D$$D$$.lW J  B)=1Zb4҉4x,2D$D$ ZbD$$D$$G.         $ ( , |[^_]Ðt&= G=ܸ G= G= G= +=ܸ += += += uT= }= ?)}EE +E)$v= G+ ))=9|[^_]Ð=8 Bt$E $D$Ut.Ur vQ5H B9cP29Qx  -t u+ 9yQA Aq qPA9PQ@OSMDfBatBa @&€V-fF=H P9B29WF\5  t&t =mu+V V FV~ft&F=H P99B29F5 t&t =u+V V FV~t&G H PM9B29Ew= 5 &t =u+W W GEWGF H PM9*B29E~}5 = &t =u+V V FEVFMUEMEU)ЉEMD$<$%*<$"+A7,,D$D$$~)v,,AD$D$$F),,uD$M,,D$D$$(s,,3D$D$$(= G= G= G= G= += += += +E) )B@ =H D h&@ 5H D z@ H D M!t&@ =H D }t&@ =H D h&J fJfZbJCfJ  #NK`r N<$(MU) 1v9y B R)9v?T$t$ D$D$$&}< t$$T$N( p pW\O`r[MO P5 P`rPPoBPPDP  L  L  L  LtN OwN Ob^N zOEN [OUWVSgfffEED$EeU1҉$F&El|닅|)Ɖ)‰ЉUE)ȉ)‹E)׋Ul}pUt}xl}0klEE-E-ET<:U)Nj|k9wu- D$D$ $B# İ믍&Ue3u Ĝ[^_]$UWVSÃ,d h x5пh Eh uKh 0d i i =` ۿi h -d i Ei t&$t$D$ D$ ,pU0$t$D$ D$ UnÉ ؉uEU9` v(v9r` \ =d =h tj8h = n 8;t>9w u- D$D$ $! İ믍&,[^_]UWVSÃ\eE1 E0E}th8]Ƌ5 n 8;t>9r=u- D$D$ $! İ믍&Ee3\[^_]ÍEƉElj$t$D$ D$ lq0$t$D$ D$ pÉ ؉uG;EUƍt& 9r2"v'UWVS9ru- D$D$ $ İ믍&Ee3ue<[^_]Ít&}о̉)0 ҉uC9<9r!fUWVS9r u- D$D$ $ İ믍&Ue3u<[^_]Ít&E-ލ]3%'UWVSLeE1ɍ]эuȺgfffgfff)9k]ĉv~(ȃ)ʉЉ)9tԉډ]ăx:gfffuĉ֍t&))0y܋uč_.gffft&É))0҈ C9st&9r}tn8]Ћ5 n  8;t>9r=u- D$D$ $ İ믍&Ee3u$L[^_]Ít&E-ٍ]ҍukSt&'UWVS9ru- D$D$ $ İ믍&Ue3u<[^_]Ít&E-ލ]c'UWVS\eE1UƉUt&tB suP8; nr U 8uUe3\[^_]Í&? 89 nw &9 n 8w #c 8 v59 nw ̉0 89 nw 0 89 nwb ; 8lt&D9 nw Q09 n 8w ̉)ǍG0 8t&?? ʁ<:̉)؉=v?<:f- D$D$ $ İt& L$D$ $ İv]vø)Dž׈Cu;]v!EƉύ 9r} ]"v  8;9 nwދ=uϡ L$D$ $ İ륐t& L$D$ $ İv L$D$ $y İqv L$D$ $I İv?X@80Ѓ??i@<8f L$D$ $ İ1v L$D$ $ İv L$D$ $i İ6&'UWVSÁEU8e M1ɉ@<=r;qP001D$D$$f P;P$҉$x"D$D$$% PJ9Hi((xD$D$$=rfv;q0҉0x"D$D$$=r;q( 00xD$D$$Jq  P;P $҉$x"D$D$$ PJ9H- (҉(x"D$D$$ P;P, t&$҉$x"D$D$$x PJ9HT (҉(x"D$D$$4 P;PL v$҉$x"D$D$$ PJ9H((x#D$D$$< @Et$øu@ED$Egfff$U^uC-l))ƍF0C)ƍ)0K))ƍF0C))0 MC-)B0C)0KMC T)B0C)0K MC :)B0C )0K MC:)B0C)0KuCZC 2)k<)Ή)B0C)0K P;P $҉$x"D$D$$ ] !ʁ t€H ҋP+$t 9p3މ؃9t5 t&  Q΀ƃ9Quދ  Q QU@\$T$$ XPJ9Hx҉xx"D$D$$  PJ9H(҉(x"D$D$$m  PJ9Hx҉xx"D$D$$(  PJ.9H(҉(x"D$D$$  < @t&P+P у9tt&ɀу9uT@  < DžtDžx+Zz B@<Dž|DžTDž\DždDž`DžhDžlD$ 8D$D$4$` x!\$ D$hD$$ g2b2 B HD8y t&8xBB *B A2Me3 y[^_]fHQ;H  ƍA29H Fx5 -t& NPу PP H +PP;PHp P PJ9H P @OSMH@eade@r @ =r@ rD r<&Bu0(҉(!D$D$$  PJ9HP PP PJ9HP @osmc@onve@rt 0f@ .7@Q @PJ9HP PP PJ.9H)$P @@treehttp@://w@ww.o@ pens@tmap@.org@/api@ /0.6 <@$ @ PJ9HTP PP HÍQ 9PL҉LD$D$$` P @@DSort@.Typ@e_th@ en_I @jf P @Dens@eNodf@es @ P;P*P t&P @OsmS@chem@a-V0f@ .6 @P;P"P t&"P Yt&HQ;H  ƍA29H YF5 t& NPу P PH +ۉHP=rW ;q00LD$D$$ P;P$҉$x"D$D$$B HƍQ 9P\҉\x"D$D$$ P;P$҉$x"D$D$$ HƍQ 9P\҉\x"D$D$$u P;P$҉$x"D$D$$4 HƍQ 9P\҉\x"D$D$$ P;P$҉$x"D$D$$ X4S 9P{\\xD$D$$e+vJu8HQ;H jr295H {A}  uc qPу P PH +PH=r5@ rD  rrvt=u됡,,xD$D$$R <@TDžd)X`D$4$^4$[ *P 7t&,,qD$D$$O,҉,D$t&x҉xD$D$$< ft&HQ;H &эQ29H yP\  t muH Pу PP H +PP;PH$P HƍQ 9PKdÃ1 ׉4u8t&5 NˀÉN1 u֋5 N NP;PP HƍQ 9P8dmÉǃ1 ׉4u 5f5 NˀÉN1 u֋5 N NP;PP HƍQ 9P'dm Ã1 ׉4u 5f5 NˀÉN1 u֋5 N NP;P P @ rD  ryf@<ƉDD1 ׉@t:  {΀ƍOK1 uԋ K KW&8d҉щ҉փ1 tIߋ4 x΀֍_XЉ1 uա X44Y,,xD$D$$T 4$d@)ڃ1t&9y B R)9vk2T$\$ D$D$$QQlQjv농v< \$$T$ X X@ D r rQ؃؃U؃щڃ҃Q UWVS,L ܱ҉EU= n8t&U49w t; 8tR8tʀ tńt9w׋ uȍv- D$D$ $b İ뜍&Emud8[E- D$D$ $ İ 8;9w5u뫍v=t`8v 8;t>9ru- D$D$ $ İ믡8fE|t&L ,[^_]Ë= nt&'Uȸ x tlf P;P  tna! P;P  toJ! P;P  th3! P;P  t!!fv⍶&v녍v댍v듍Uȸ xtfɍ&v  1(UWVSÃleE1UƉUt&tB ruP8; nr5 8uUe3 l[^_]Í&  3w? 89 nw &9 n 8w #c 8 v&9 n̉0 89 nw1 F0 89 nw5 ; 8rf9 nwg Q09 n 8wb ̉)ǍG0 8t&yoЃ??i@<8ϐt&̉4)=f89 nw  "&89 nw5@ ?8a- D$UD$ $U İ t&i?<:'&$Ll?Q L$D$ $ İ:vuvƸ)Dž׈Fu;uv!EƉύ9r}ju"v  8>C9 nwދ=uϡ L$D$ $ İ륐t& L$D$ $ İv L$D$ $Y İ8v Hp?? ʁ<:\t&9 nw g9 n8vhft89 nw  ;8f9 nw  l9 n8w= 념t&9 nw  a9 n8w p9 n8w= o9 n8w5 s8v9 nw a9 n8w= m9 n8w5 p8t9 nw= q9 n8w5 u9 n8w  o9 n8=P- D$D$ $ İ$ L$D$ $i İv- D$UD$ $7U İt&- D$D$ $ İ=t& L$D$ $ İlv L$D$ $ İqv L$D$ $q İ)- D$D$ $E İE- D$D$ $ İ;- D$D$ $ İ=- D$D$ $ İ7- D$D$ $ İ1- D$D$ $i İ1- D$D$ $= İ+- D$D$ $ İ%- D$D$ $ İ- D$D$ $ İ!- D$D$ $ İ=- D$D$ $a İ7- D$D$ $5 İ1v'UVSȸ Ը  ظ 5 n81&8  89r u- D$D$ $b İ럍&85 n  8;t>9ru- D$D$ $ İ믡8fԸ ظ = v1u'- D$D$ $ İ8 [^]Ív/8먍t&讷8듍&+8뀍t&8rUVSȸ w;$lt&k/8; nr 8[^]Ð[^]t&Ը t,5ظ 1wԸ ظ PX q7\- PX 5 n8+t&8  8tb9ru- D$D$ $ İ룍v[^]X _t&=ȸ [^]SvKX t&- D$D$ $B İ<UWVSÃ,ȸ 7f5ظ   f,[^_]f n8 8>J9r u- D$D$ $UkU İ륐t&,[^_]!f8 n$ 8>*9r u- D$D$ $UU İ륐t& n8$ 8>9r u- D$D$ $UkU İ륐t& n8  8>t^9r u- D$D$ $UU İ멐ȸ ظ vػU!8U!&  8;t>9r u- D$D$ $U_U İ멐U8U%&  8;89r5u- D$D$ $UU İ륐t&ػU)8U%&  8;9r u- D$D$ $UcU İ륐t&ػU8U%&  8;9r5u- D$D$ $UU İ륐t&U)8U%&  8;9r5u- D$D$ $UcU İ륐t&U8U%&  8;89r u- D$D$ $UU İ륐t&  2  ,[^_]t&,[^_]fUWVSÃ,ȸ 7^5ظ   f,[^_]f n8 8>J9r u- D$D$ $UU İ륐t&,[^_]f8 n$ 8>*9w u- D$D$ $UCU İ륐t& n8$ 8>9r u- D$D$ $UU İ륐t& n8  8>t^9r u- D$D$ $UWU İ멐ȸ ظ vػU8U!&  8;t>9r u- D$D$ $UU İ멐U 8U%&  8;89r5u- D$D$ $UCU İ륐t&ػU8U%&  8;9r u- D$D$ $UU İ륐t&ػUy8U%&  8;9r u- D$D$ $UCU İ륐t&U8U%&  8;9r5u- D$D$ $UU İ륐t&Uy8U%&  8;89r=u- D$D$ $UCU İ륐t&  G ; ,[^_]&,[^_]:v'UWVS=peE1tM=E CEu+t)ʋM +M1‰|ȉxU|)xxExx tD$ET$ U$T$D+EUU1}jUEEU}w UEEU}9 UEEU} UEEU}ueExȹ t |EE0ȹ E=Ĺ pt&xEe3Ĝ[^_]Ðt&DžxyƍҍZ֍UxӸgfffC.))ƍF0gfff)Ǎ)gfff0K)ƍ)ǍG0Cgfff))ƍF0Cgfff)ƍ)gfff0K))ƍF0gfffCgfff))0KK))DžҍG0׈A9sf9r,uXgfffC.))ƍF0gfff)Ǎ)gfff0K)ƍ)ǍG0Cgfff))ƍF0Cgfff)ƍ)gfff0K))ƍF0gfffCgfff))0KKt&))DžҍG0׈A9sf9r,uXqgfffC.))ƍF0gfff)Ǎ)gfff0K)ƍ)ǍG0Cgfff))ƍF0Cgfff)ƍ)gfff0K))ƍF0gfffCgfff))0KKt&))DžҍG0׈A9sf9r,u XgfffC.))ƍF0gfff)Ǎ)gfff0K)ƍ)ǍG0Cgfff))ƍF0Cgfff)ƍ)gfff0K))ƍF0gfffCgfff))0KKt&))DžҍG0׈A9vt&9r싵pxU0ЉE UXt&]Uxȹ E ExEE0ȹ EĹ p(xPt&xvۍ}E-މ=ȹ }$t$D$ D$ 4%U0$t$D$ D$ U#É|wEU9Ĺ '9r=ȹ pĹ  x]}U Ufvxt&@-u X&@-uX~&| }Í&v@-uX&tEE-]xvx]u׉|t&$t$D$ D$ #0$t$D$ D$ !É ؉u|BĹ 9v9rĹ  =ȹ x} }t&fv}ftv]EuE-ȹ ۃމ|t&UWVSȸ .Ը =ظ = n8-v8  8f9ru- D$D$ $: İ럍&5ȸ [^_]á8= n$ 8;9r u- D$D$ $ İ뫍v8= v1 u'- D$D$ $o İF 8 vD|?Fv72fP5ȸ u 1=TT [^_]1̡8&Ը ظ I&8.t&88UWVS<]UPu Mv Z1 Pȸ u 1҃=T…T J=H8= n9w `  9ǣ8w  9ǣ8w   9ǣ8w  o9ǣ8w T  59ǣ8w^  c9ǣ828 5UMl<[^_]Í&Pt&& nhuԉ]ЉEܡ8u"t& 8?9ru- D$D$ $v İ뫍v= n89r X  9ǣ8w>  9ǣ8w H  9ǣ8wR  o9ǣ8w \  59ǣ8w  m9ǣ8$=  Eu l\$t$ ED$E $MUк<[^_]ø P nɉEܡ8uԿu܉]  8?tn9wu- D$D$ $ İ믍&- D$D$ $Z İt&ȸ ]Ћuԃ  u& n8u!& 8;t>9wu- D$D$ $ İ믍&=ȸ \=/]C=ȸ v 8u$ 8;9w u- D$D$ $ İ뫍v P]Ћuԅuԋu܉]"t& 8?r9wu- D$D$ $ İ뫍v=܍G;r@҉@y ۉډك1 u ʀډ1у uS5U$M EUۍSE;r `ɉ `T9ɀ 9u9Ew`҉`t&ɀ 9u9E w`҉`vt&ɀ 9u9Ew`҉`Ft&ɀ 9u <[^_]Ít&5@رۉE]ƍ&~i}&~V|$4$ou+}=ܱt&Fv9t uL mAرEp P^4O&E8u 8;t>9wu- D$D$ $ İ믍&E以諫8u 8;t>9w=u- D$D$ $ İ믍&E;8u 8;t>9w u- D$D$ $" İ믍&E ˪8u 8;9wu- D$D$ $ İ뫍v^؉š89Ew  "8W3U$M EUz5Jl$Pr$" $@ D " H 1ң< p @ t9hhiD$4D$$&G5>YD$D$$D$D$$D$D$$D$D$$vD$D$$Zp$o4 $4  1ң0 U$M EU- D$D$ $- İ- D$D$ $ İv- D$D$ $ İ|- D$D$ $ İt- D$D$ $} İ- D$D$ $Q İ>- D$D$ $% İ4- D$D$ $ İ*- D$D$ $ İ- D$D$ $ İ- D$D$ $u İ- D$D$ $I İx؍Dۃۃ؍D؍D=؍DdE譥sE蛥sE艥sE wumiC.W< 3- D$D$ $O İ'UWVSӃ|EU e M1ɉE UUUuRuHȸ upt Me3 |[^_]Ðt&ȸ 1E\EEEtt u  BTo=X oSE9rDDI9fɀ 9uU t11 55MM9MUw@@؉+EU҉ULщ҉׉Ѓ1 ȉM~E]ut&ˀ׈Ӊ1 u]uƒ ى55 50 ; 55r@ۉ@4]u)։؅ljÃ1 'ˀLjÉ1 u UM]҉ 55FE;];/M9M]EƉƒɀ ك9u)DU@&v85 n$ 8;9r=u- D$D$ $莾 İ뫍v $,  =UE訜UuU:E謝EJt&D$D$$[D$D$$3 UMt&6  ؉tEt ];EU茛&诜 EU/EbM9VvV? 3=%-EUҚMt U:؉l&щڃ҃t&\D*&UvMʃ~؃D$D$$  EEƍELEEE轚ۼvUWVSӃ\UEE}UċUE̋E UUEEUEE E=ȸ =Ը ظ  n]ЉMԉEء8u-v8  89ru- D$D$ $  İ럍&Ը ظ \[^_]Ít& n8]ЉMԉU؉v 8?t>9r u- D$D$ $r İ믍&]ЋuԸ ظ T =ȸ ,=8]Ћ]؉uԉt& =8>t=9wuס |$D$ $ȸ İ뭐t&Mອ]Ћuԅt}t]]؉u-8  =8t99wuˡ |$D$ $$ İ롐]uJ]]؉u =8>t=9w桰uء |$D$ $蹷 İ뮍u]d h h h 0d i i ` =h tbh u =8;t=9w uס |$D$ $ İ뭐t&$ED$ UT$EU$T$E̋UM8Ը }ظ $ 8;9w u- D$D$ $N İ뫍v0=8]Ћ]؉uԉ =8>Q9w⡰uԡ |$D$ $ݵ İf#U;<t <E<EU؃5U5EЉUԋU;r@@؉+EUԅ҉UKщ҉׉Ѓ1 ȉMIE]؉ufˀ׈Ӊ1 u]؉Eu܈EEU5Mĉ55EEUUEẺU U\[^_]w&}׉UЉ$t$D$ D$ <0$t$D$ D$ É uMЉB}` 9t&9r` \ d 3u% =8;9w⡰uԡ |$D$ $譳 İf=PX 舸- D$D$ $ İuMQEM$M n輨t&UWVSÃ<ȸ /t=ظ fJ } <[^_]Ðt& 庎=8u։]$t& =8>!9= nwދ uϡ |$D$ $ İ륐t&55 ; EU}؉+EU҉Uǃ}1 ׉U]؋]u܍t&ˀÉ1ރ u]U]؋u܈ 555 <[^_]á8 n$ 8?:9w u- D$D$ $UU İ륐t&=8u։]"v =8>A;= nrދuϡ |$D$ $x İ륐t&=@=@lD$D$$ԣ u]d h h h 0d i i ` =h h && =8;Y9= nwދuϡ |$D$ $x İ륐t&u]d h (h yh 0d i i ` =h tbh v =8;t=9= nw⡰uԡ |$D$ $Ţ İf  =8;9= nwދ5uϡ |$D$ $` İ륐t&  =8;9= nwޡuС |$D$ $ İ릍ȸ ظ 3;v}׉U؉$t$D$ D$ \0$t$D$ D$ É uM؉B}` 9:t&9r` \ d }׉U؉$t$D$ D$ 0$t$D$ D$ É uM؉B}` 9t&9r` \ d   +  c 5 fۺi }މh -d i Uۺi }މh -d i U>؃E Zt&UWVSÁEeU1҉40ȸ /9t=ظ  }!Ue3#[^_]Ðt& ҋ4D4d h dh lh 0d i i ` =h i= nh 8%& 8;B9r5u- D$D$ $n İ뫍v55 ;  $r8=@=@x%D$D$$訝v؉+ $҉$bǃ,1 ׉ D ,$&ˀÉ1߃ u≝,, $ 4400545DE]㍅Fv9t u1ҍD=v8 n$ 8?9w u- D$D$ $x İ럍&4r4d h Xh *h 0d i i ` =h d= nh 8#t& 8;:9r5u- D$D$ $莛 İ뫍v؃= n8t& 8;t>9r u- D$D$ $  İ믍&08 8;R9ru- D$D$ $薚 İ뫋= n8 8;t>9w u- D$D$ $2 İ믍&0x8 8;z9ru- D$D$ $辙 İ뫍vȸ ظ (Cv4׉$t$D$ D$ $0$t$D$ D$ É ؉u4B` 9Ev9r` \ =d 4׉$t$D$ D$ 0$t$D$ D$ É u4B` 9t&9r` \ =d Z  0c  +    5  4n记螰ۺi h -d i 4ۺi h -d i 4, $: E8t&t&'UWVSÃ|EU e=}1MĉEEUUEȸ UUU a=Ը ظ tv n8'8  8tB9w u- D$UD$ $KU İ띐t&Ը ظ T t=}Pt!X 9tq跮 r諮=X ȸ 85"t& 8?; nrߋ u- D$D$ $b İ맍&=<<55:55555 5 5$55555t&{uI@pu8; nr=  8<E55;  EUr9=@=@x&D$D$$a}&؉+EUE҉Uǃ}1 ׉U]]ut&ˀÉ1߃ u]E]u UE}MT$ U$Eĉ555T$U|$;t& n8$ 8?z9r u- D$UD$ $胒U İ륐t&=W + vUe3|[^_]à t$ظ ؃M n8t& 8?t=9w u- D$UD$ $臑U İ멅d h x%h u8i h 0d i iۿi h -d i $t$D$ D$ 0$t$D$ D$ É uGd ` 9‰s? \ ` \ d ` J9 d ` r¸h H}E|$ D$EUM$EĉT$UԸ '=8"t& 8?9 nwߋu- D$D$ $ İ맅d h x%h u>i h 0d i qۿi h -d i &$t$D$ D$ $0$t$D$ D$ É ؉uGd ` 9ЉvE& \ ` \ d ` J9 d ` r€=h tf8h t& 8;t;9 nwu- D$D$ $~ İ뫋UE}MT$ U$Eĉ|$T$UԸ F0d h x%h u:i h 0d i mۿi h -d i v$t$D$ D$ 0$t$D$ D$ É ؉uGd ` 9ЉvE& \ ` \ d ` J9 d ` r€=h tf8h t& 8;t;; nr5u- D$D$ $ތ İ뫋U}T$ |$NVb誴! -18޴ -1bŴ 謴 -1蓴 -1Եz -1軵5]ġ ۣ uIU UR11EUM蚳MUЉ 聳 nEֹ(\MuE\Ef豹  UX[E]ЉiڸS=}Љ躎E7 h:>GEUB O- D$D$ $s İ+]Euً]+vUWVSÃ|EU e=}1MĉEEUUEȸ UUUj a=Ը ظ tv n8'8  8tB9w u- D$UD$ $kU İ띐t&Ը ظ =T t>} Pt!X 9tq֡ rʡ=X ȸ 8i!v 8?; nrߋ u- D$D$ $肈 İ맍&=<<55:55555 5 5$55555t&{uI@pu8; nr=  8<E55;  EUr9=@=@x&D$D$$聆}&؉+EUE҉Uǃ}1 ׉U]]ut&ˀÉ1߃ u]E]u UE}MT$ U$Eĉ555T$U|$;t& n8$ 8?z9w u- D$UD$ $装U İ륐t&=u I)vUe3|[^_]à t$ظ ؃M8Uv 8?t;; nru- D$D$ $讄 İ뫅d h x%h u:i h 0d i kۿi h -d i v$t$D$ D$ 0$t$D$ D$ HÉ uWd ` 9s?v \ ` \ d ` 9Уd ` rĀ=h th8h !& 8;t;9 nw u- D$D$ $N İ뫋}E|$ D$EUM$EĉT$UԸ `8U%& 8?9 nwߋu- D$D$ $誂 İ맅d h x%h u>i h 0d i qۿi h -d i &$t$D$ D$ 0$t$D$ D$ @É ؉uWd ` 9v= \ ` \ d ` 9Уd ` rĀ=h th8h !& 8;t;9 nwu- D$D$ $F İ뫋UE}MT$ U$Eĉ|$T$UھԸ ud h x%h u:i h 0d i mۿi h -d i v$t$D$ D$ L0$t$D$ D$ É ؉uWd ` 9v= \ ` \ d ` 9Уd ` rĀ=h th8h !& 8;t;; nr5u- D$D$ $ İ뫋U}T$ |$[Izǧ -1讧 -1b蕧 ֨| 轨5]ġ ۣ uKU UR11EUM蜦MUЉ 胦 pEج(^MuE\Eh賬  UX]E]ЉkڸS?}Љ輁E l7 J>)EUB 1- D$D$ $u} İ ]Euً]-t&UWVS$eE11$󫡸DDžLu1=(L=DH~DžXu5\DžX $h~Éơ ~ 4H$(~ǡ < ~$}t‹  ~$}xV ~&¸L#=^5c=~.H~D$D$hD$D$ $zH~dF+@۸t*Af= t uf.1@xa"Dž Dž DžhDžDDž@ |z"u=H~!y |ɉt3yY?*5|;^r) ;~ x=`v|&&htHP9w9&=`v|ډӉÃ!=XuRtD  ,D$ T$D$$D$($XĦ/=|= \X t&uƉ賔t$ D$D$$xd` t&uƉ{t$ D$2D$$wxhuƉ褄t$ D$ED$$0xl{t$ D$RD$$xpRt$ D$_D$$wt)t$ D$lD$$wT$ D$D$yD$$wD$D$T$D$ $]w$ D$D$T$D$ $1w,( t T$ D$D$D$$v40 t T$ D$D$D$$v<8 t T$ D$D$D$$vD@ t T$ D$D$D$$ivLH t T$ D$D$D$$7vTP t T$ D$D$D$$vxEtBD$ D$1D$$uEUD$< D$D$ T$$uEtBD$ D$CD$$uEUD$\ D$D$ T$$eu\Ue3i[^_]Ë4`DžX =dDžX =hDžX=<ɃX=~.H~D$ D$hD$D$ $tH~ $@t*Af=t uf.5@=g$uD$D$B$s($ @555"5"5M=`v|2;|=|t H LHL|09ى D9^Pʉ   |L )Ӊ\$T$$u^|B z9ÉBBB|@ D=|`v|||`v|`v|t H LHL|09ˣD9^Pȉ   |L )É\$D$$t^|B z9ÉBBB0|R 9 |D90PʍP L )É\$D$$s|B z9ÉBBB||뉡\[xoڋNv9L$D$ T$L$D$xD$$+p5||^N|5ʸtttxx||D$ D$T$L$D$$o5||ǀDP )=0~0D$D$$oH~ % of =XK11莣5z=X 1LJ=O=~.H~D$!D$hD$D$ $nH~!y 4;f5|V =H~ N {pl~]oJ Z1P)t&P@v|P/H Pntrt wҀ@nut& @ntHv|\\Dv|\ Ɉ~^0xu Dž\@>@tLtBDžDž1DžvAQ't "H  Hv|@8u w& 8\u@v|\Hv|\Dv|\0 v䋕\i  ,D$ T$D$$D$($X5|$zyHv|Džntw҃ReoqHv|Y %5Hv|x5|=`v|`v|S9|t H LHL|09 D9Pʉ   |L )։t$T$$W|J Z9ƉBBBs|D$ D$D$$U|09B BǂDPߣ |L )Ɖt$D$$V|ÉJ Z9ƉBBBsCCC C$C0C4C8C<CHCLC@CDC`CdCXC\CPCTtǀ8Jǀ8J{sxh9$ۉ|$!|t H LHL|09٣ D9`[Pȉ  O|B z9ÉBBB~e|L )É\$D$$bT|ǀDP )=0~0D$D$$R|@ ="t>"=Nt(-ND$0D$N$`Q"N"0D$ D$D$$SN"N"N0x"҉tY1҉֋=T$ D$ڃL$$I""9v0D$0D$N$POÍN"t*)؉D$0T$$P9""NNy$t&|D$D$ D$$WO~Ѓ|N15 n8 8;9wu- D$D$ $O İ뫋N0^4 DžɉUÉ׉0404EN4V0ʄ҉\mE\9$F$J;1 ;=Dq  u=Yt& ,50PT‰DžDžDž9Dž\,+9|,0x9[9PTC4 0 t˸ t tD$ D$ t$|$D$$K‰ rDž~zDž@Dž@1҉t&>x׉狽V,ω։5|V;F Dž5 n8[ 8;t79w=u- D$D$ $*J İ1XP@yxUhPTex=|=`v|`v|Wi|t H LHL|09։5D9 Pʉ   |L )Ӊ\$T$$/K |r z9ÉBBBs5|P HPH!ʃ4|D$D$ =|ǀDP )=0~0D$D$$GG(GGG G$G0G4G8G<GHGLG@GDG`GdGXG\GPGTtǀ8Jǀ8J xh9ɉ |5|t H LHL|09٣ D9KLPȉ  J5|F V9ˣ@@@~g|L )É\$D$$pH|ǀDP )=0~0D$D$$F|@ =W1 oL$D$ L$$E$|PH)ڋ)Ӊڋ31 ǀDPp 09ʉ P |L )Ӊ\$T$$F5|V N9ÉBBBse/|D$PD$ 8ЃqH'/;/1 ;Dq uxa. xouxduDž)PL$T$$yE|P+|ǀDP )=0~0D$D$$7C|5 Hv|Dž<-uDžpЍA DžDžDž`DždP߉k DžË0 v`d= ?Ȁ?ɀNFtEu pl鷽W[vKW0O4=UuDžDžU9JJMs<1$w1FډUHv|1k  0 vꉅ<|nd;pv|8@;xv|)5|1~$;F,t==t?E1>DžP't "ljPDžDž-uPDžDž11Ak 1ۉ ውʉ0 v‰= VNF~>u uvu߀{euـ{rvuЀ{suʀ{it&u{ou{nt&u{=uC<'ft<"uL{ D6L{ DAc1WЀ qk ҃:)" DžC}^89؋|F8s<9UCʸtttXX\\D$ D$T$L$D$$-|x=`v|`уh0tpx9rw9w׉=`v|v ։;||t H LHL|09ى D9KPʉ  N5|F V9ˣ@@@K|L )Ӊ\$T$$H/9t ND}V@C3F@ VD9/KDžh|CHSLr19dCHSL?Džh]MjED$E$.t Džh1tUDžh5|`9<uU5|J9xDž~(@,@1ۄy3Љ(,xÉ(Ӌ,ȉ(ڃ,}(,҉(,)PL$T$$,|P+|ǀDP )=0~0D$D$$y*5|y)PL$T$$7,|P+ xtDžDžDžL;PkT;XS5D;5H;DžфɉLljщ!ЃTD;F90x  GyxƉDCyxÉT Dž~xpDž@Dž@1҉>x׉狽ȉڃ5LC҉"9$D4 0 t˸ t tD$ D$X t$|$D$$G% tx@h N=zt(-zD$D$z$#NzND$ D$D$$&MzNzNzDž,Q N  NN9rѡD$0D$z$#ƍzNt*)D$T$$u#NNzz[; NQ N=B1҉׉T$ D$ $\$p551Ɖ׉=$T$t$|$ oTȉ|$ t$$T$LoL  ~8D$L$t$ D$$ 顱t&D$0D$z$3!ÍzNt&)؉D$T$$ ~ONNzz)5NlD$ D$D$$)N믃Dž)DžDžDžDžDžDžDžDžDžDžDžzt>z=rt(-rD$0D$r$]zrz0D$ D$D$$!rzrzrDžDž|+Hz 1ҋ59tSF| Dž(Džz=z90D$0D$r$Írzt*)؉D$0T$$*zzrrRO9 `1Is\Ӄ؋3sz;zHz9z z5б=ıȱp  t ;sj)+#8x11 v9| 9wut&0;r`DžDžDžf9؉v)؉+#0p11 9B|;f2렋 бı5ȱ;si)+#p81ى1 J9|;t&w~;r`9l ,|95h DžDžN9Љv)+#H01߉1 tz9D;t&2먋s{ CKP҉`(x5wP҉`x5w `HӉ΃05~8|D$D$D$T$ $n|#釩0D$0D$r$ Írzt*)؉D$0T$$Uzzrr0D$0D$r$WÍrzt*)؉D$0T$$^zzrr=`9~)с5~,9+5H9~x$J)zЬЬD$ @D$D$$鹧9΋Sz`P9~)с5~-X9}ً+5~ H 9!p9 `PH Xp)z)z}^89F8t Džh|s<9C<dDžhUDž鰧;pv|%DžhDžDDž骚=t;ؤؤx*҉T$ D$l D$$  pl1o)PL$T$$|P+|ǀDP )=0~0D$D$$p59}v UM.tw|ǀDP )=0~0D$D$$0P)É$\$D$|P+&Ë5|dq`qVʉF:xNz^}JDžɉUÉ׉= FVtERF5|;Nhw;{Q\[NtttL$D$ D$xppttD$T$L$$h5||^N|2ʸttthhllD$ D$T$L$D$$|xωމ=`v|vh8tpx9wr9sى;tY||t H LH|L[&|B x`v| h9r=,=4=|=H~   u$lhtp,( t9"|9s(,40 t9|"9v049h~h9l}l9p~p9t}t tx\X t9"|9sX\d` t9|"9v`d+@;x~$x|M]=X=t9=H~pK1=d 9` #|9s؃9L|9wBx1D$$ \$ t$D$$ 4$%=,<`dD$ET$D$L$\\$ t$|$$[;X 'ヽ=4H~ !=t =H~!Ed<D$`T$ L$\t$D$$tDž9xt=H~ w<t~ډtP$ku DžS=(u䋕؉$*k΋؉$k뵃=(tډt؉ $j뇃= ;~ Mヽ/ʿ11Dž95D$$ D$$ D$$x D$$` D$ $H tpD$$4 t\D$$ u@5:u.P:u"P:u@:u Dž1tDž ؉Dž;Lwt =uZ11"x"1k"5wp t $ Džt-u p 5t ؉"((5,ڃu11r!a!؉X!DžLH $ t9"|9sHLTP t9|"9vPT+;EMEUM3<8 t9"|9s8 0ރv1U߉ƒ9xe1۾(79` | t܀ tXf~$1Se1۾(Wƒ9xvu{eu{ru{su{ifu{ou{nt&u{=kC<'t<"[L{ L{ DA"1WЀ wPk ‹:ދ5|5|`q0dq4F@VFl}U;vH995|FPVTNFPVTQU뜋|ZHrLLL```dMddZH]rL'<xU6D$@$LuD$$6;r1y Q̷v{e{r{s{i{o{n{=fC<'t<"oL{ L{ DA61WЀ wPk ‹:ދ5|5|dq`q04F@VF鵷DtjhuHDžDDžl4D$ D$XAv|DžDv|1K u\;r&19xpt<8t6‹#Džk$D$LLtD$$uډ=u5;5r3=5t*="t#-"D$D$"$"p52)oL~}6U9vDžODžhx9@vL$$t DžhUH9Ф9Ĥ~1ɉÉ։U#tM0MM9t Džh @|t9Љt9}U;v;Hsv9vr1AL5|FPVTlL9FPVTtDžhU9udx)\$ D$D$<D$$$"EF  m3|luC t*8t‰\|<{gA|ft*8t‰|>{ >x*\$ D$ D$D$$:111)PL$T$$|P+9Ŵʴt&'UWVSE $$e$ 1dD$D$$ }D$hD$dD$lD$\plڐt&D$?B)؍D$$;ڸTމ/t ) 8tމÉ5l9s  D$$;lv:HP 9lst&BJ< u-9lr X@lp t&< u܉͉lp5l9s8{ u${D$$X5]uۉ$p$_lp$ pl%$;-u,ڸ] ve 8tM~($D$ D$D$ $6$o9‰T$xu#$A:puA:qf$sb$rI$¸y-t* 8t؉$p EE$P@$${-]$À;D$$p$@Blt [ A& p$E*v$ -$m 8t؄S$c 8t؄I$# 8tل $ 8tىً$ 08t$08a SC 5l9 t t߀ 5lD$ D$$SDC5lD$ D$D$$Y1ۉ؋$ e3<[^_]áȢȢxD$ D$$p$p둡D$\ D$$rcJ$E( f$ 08t$ 08t$08R   ̢̢x!\$ D$ D$$$- kv$|$\=D$ D$$ @fYz9D$xu$B:{=$-o"$D$n$uD$\$D-=t_xD$\9=u =t/=~!D$ D$D$$=T==DuL=HuC=Lu:=Pu1=Tu(=\u=<u=Xu =+=~,۸^t؉D$ D$eD$$st0D$D$A$7=t$(== D$ D$$s qM1D$D$$+uSD=1\$ D$D$$+UH(|$luD$lX|$hu4|$du-T$lT$l)L$l)D$hL$d=|$l~D$l=~|$d~T$d~|$h~T$h~111$E=w;t $&tD$pD$$=Du=u=(u ==B:5555555 5 5$55555{uI@pu= =D$D$$5=( $@KL8$P$0F~=Pu=Tu=Hu P?D$$@\$T$D$ D$D$$ =~%D$ @D$D$$>=tu, (1` ȣh ȉd ȉl ڣp  t t ==<t1(S=~mtd;s\PT$(PT$$PT$ PT$PT$PT$PT$D$<D$D$ $38= v0=u'- D$D$ $` İ=İ8 t3\xD$D$$= 5tttD$ t$L$D$D$$;t!\$ D$D$$11s&뻡D$D$$x$!=ı1ȱ̱ ʉD$xT$|T$x$L$xбԱ|D$$T$<.$GL,ı 1ȱ̱D$D$$t$08u@t- uJP0t닔$08u@t- y=uJT}4t닔$08u@t- uN\ 8,t鋔$08u5t7~<u-~ $8uG$D$#$$ٸ208ujt1<`-2~D$t4t u<t$D$C$&$D$$M9D$xu$A:Nu A:Ot]$D$$t8P9D$xuD$B:Qu1B:Ru%B:SuHD=$D$y $Pu(L@<$D$$ uP$D$T$uT$D$^ $t]$D$$uQ\a$D$[ $t|X$D$i$2t($ٸs08u-t <`t닔$08ut7 t&$08u-t dWhHt鋔$08utu-~ $8u*$D$$u$x pt$D$l$>|$D$$uf$D$$yu<$D$ $Ou"=u $D$$t>$D$$umD$ D$$\$D$ $ou#$D$#$1t($ٸ908u2t8-9$9tw1<-u 911҉D$8T$td@0~T~$z-{t;D$ D$D$$L믡D$D$$h9D$xu$A:u A:tb$ھ8tq$ٸ08D$D$$访_~d $DJtyD$lkL$l DЉD$lDJuD$dD$ht$ھ8u$ٸ08t  䍄$HD$$ݔ$ݔ$ݔ$$$$ݜ$T$L$\$ D$$藾uB^ ؐ60& ءD$,D$$\v $:08t1 DJ kL$d DЉD$dڃ=t= x5w5w$D$%$D$` 1D$xOT$Xx֋D$`T$PL$LƄ$D$$D$P$耽T$P9\$XL$LD$T.$< tH< tD=x9t9t;L$x^9T$xT$p|$T[T$pT$xg$HD$ $ݔ$D$$ݜ$T$PL$LD$$mT$PL$L݄$PX݄ٞ$`hٞ{pټ$$t˴ f$x٬$ۜ$٬$$9-9٬$\$p٬$9u~9KL$p3{K =C~UC T$PD$CD$CD$D$D$D$+ ỉD$ $T$P5x9D$x׋L$pD$p D$p;sK CaT$`$@$D$D$L$ $胺' ؋D$x׉D$pL$pL$` $λx+ ĩ=t~&D$ D$dD$$tD$ D$ D$$葹 = x9=~SS T$ST$SD$+ D$+T$iD$D$ $axKމL$p  L$x;t$x:9FN.= 5wlʈ| lʈx 5w lʈplʈT$XT$X9tRs9}s9t$p:L$pS 9ʉT$xT$`|L$pL$`9|ƋL$x9ȃL$`뮉ƃ= x =|  D$D$$BD$SD$$  ދ;xF D$FD$FT$D$+D$D$)؉áỉ$\$ ^P T$PT$PT$+ D$\D$ỉT$D$ $i[9usD$xr=KsC C~JD$+ T$T$Pỉt$L$D$D$ D$$T$PL$x9ST$x3KS =C~UC L$LD$CD$CD$D$D$D$+ ỉD$ $uL$L=xD$xsK Cyt$p $ P] p$ :D {RKL$x99D$p9tw :9#=~8+ D$=D$ỉD$ $蘵xFt0@uyGt$xh~סĢĢ$D$D$L$ $݄$PX~݄$`lhc݄$Y۞T݄$HCټ$p݄$$ f$٬$p٬$݄$٬$x ٬$٬$| ٬$܌$٬$ ٬$ vD$hDJ\kL$h DЉD$h1D$\+UWV M u}Uɉu}EuEϋuUu9v9щ1 v9vL11ɉȋMt؃ڃ ^_]Í&u 1ƋM1lj뾍ЃUuE;uv9s1뛍vuڃES]UU]At&ME +EM UuMUU ׉u։e9։Ur UM9s;ut1t&O1UWV0M u}Uɉu}EuEu}UЉU؅}܉u,9MvЉu܋EԉFu EU0^_]Ív9v$NEԅtEU؃ڃ0^_]Ít&ЃUuuM9M9M؉~븍&U܅u 1u܉E܉1u܋Eubf]U]-ڃEt&M¸ +EE؋EMM ЉEȋEM؉E̋EMMM }u}܉e9rF9Er=M)׉MMM Љ~t&U+UljU9u+EU뷐UWVEUu} Uu59wau 1ƋM1҉ljȃ^_]Í9wЃUu9;u911ɉȉ^_]Ðщ1ȃ^_]ÐME +EM UuMUU ׉u։e9։Ur0UM9s;ut1qt&1`t&O1ȉ^_]ÐUWV UM}u ҉ȉMu9v?1҃ ^_]9wLʃMuQ;}E)։EE ^_]fu 1lj1E멍t&ȉ ^_]Ðt&MU +UUMM UMU}MUMM ։uue9r+9r#M)։MM ^_]9u+EUэt&9U]Ít&'UWVSO迬 )t$1ED$E D$E$ 9rރ[^_]Ë$ÐUSË tD$ED$$裬 []ÐUStfЋu[]ÐUS[Y[0123456789Read-opening: %s rbstandard input@oname@otype@id@lon@lat@uid@userstdoutWrite-opening: %s Write-reopening: %s Write-closing FD: %i (invalid)nodeunknown objectrelationRead-closing: %s %llis. %sC.osm.osc.o5m.o5c.pbf"', :;|&\"' ,:;|&\.poly0123456789.--o=_%02i%s-v-B=-b=%s,%s,%s,%s--drop-author--out-statistics--statistics--out-osm--out-osc--out-o5m--out-o5c--out-pbfosmconvertOsmSchema-V0.6 DenseNodesHistoricalInformationtimestamp= OSMHeaderOSMDataPointers: %p %p %p 1.2.3.3 "> generator="Osmium (http://wiki.openstreetmap.org/wiki/Osmium)" input file name - read from standard input -b=,,, apply a border box -B= apply a border polygon --complete-ways do not clip ways at the borders --complex-ways do not clip multipolygons at the borders --all-to-nodes convert ways and relations to nodes --add-bbox-tags adds bbox tags to ways and relations --add-bboxarea-tags adds tags for estimated bbox areas --add-bboxweight-tags adds tags for log2 of bbox areas --object-type-offset= offset for ways/relations if --all-to-nodes --max-objects= space for --all-to-nodes, 1 obj. = 16 bytes --drop-broken-refs delete references to excluded nodes --drop-author delete changeset and user information --drop-version same as before, but delete version as well --drop-nodes delete all nodes --drop-ways delete all ways --drop-relations delete all relations --diff calculate differences between two files --diff-contents same as before, but compare whole contents --subtract subtract objects given by following files --emulate-osmosis emulate Osmosis XML output format --emulate-pbf2osm emulate pbf2osm output format --fake-author set changeset to 1 and timestamp to 1970 --fake-version set version number to 1 --fake-lonlat set lon to 0 and lat to 0 -h display this parameter overview --help display a more detailed help --merge-versions merge versions of each object in a file --out-osm write output in .osm format (default) --out-osc write output in .osc format (OSMChangefile) --out-osh write output in .osh format (visible-tags) --out-o5m write output in .o5m format (fast binary) --out-o5c write output in .o5c format (bin. Changef.) --out-pbf write output in .pbf format (bin. standard) --out-csv write output in .csv format (plain table) --out-none no standard output (for testing purposes) --csv= choose columns for csv format --csv-headline start csv output with a headline --csv-separator= separator character(s) for csv format --timestamp= add a timestamp to the data --timestamp=NOW- add a timestamp in seconds before now --out-timestamp output the file's timestamp, nothing else --out-statistics write statistics, nothing else --statistics write statistics to stderr -o= reroute standard output to a file -t= define tempfile prefix --parameter-file= param. in file, separated by empty lines --verbose activate verbose mode osmconvert 0.7Q This program reads different file formats of the OpenStreetMap project and converts the data to the selected output file format. These formats can be read: .osm .osc .osc.gz .osh .o5m .o5c .pbf These formats can be written: .osm (default) .osc .osh .o5m .o5c .pbf Names of input files must be specified as command line parameters. Use - to read from standard input. You do not need to specify the input formats, osmconvert will recognize them by itself. The output format is .osm by default. If you want a different format, please specify it using the appropriate command line parameter. -b=,,, If you want to limit the geographical region, you can define a bounding box. To do this, enter the southwestern and the northeastern corners of that area. For example: -b=-0.5,51,0.5,52 -B= Alternatively to a bounding box you can use a border polygon to limit the geographical region. The format of a border polygon file can be found in the OSM Wiki: http://wiki.openstreetmap.org/wiki/Osmosis/ Polygon_Filter_File_Format You do not need to strictly follow the format description, you must ensure that every line of coordinates starts with blanks. --complete-ways If applying a border box or a border polygon, all nodes the borders are excluded; even then if they belong to a way which is not entirely excluded because it has some nodes inside the borders. This option will ensure that every way stays complete, even it it intersects the borders. This will result in slower processing, and the program will loose its ability to read from standard input. It is recommended to use .o5m format as input format to compensate most of the speed disadvantage. --complex-ways Same as before, but multipolygons will not be cut at the borders too. --all-to-nodes Some applications do not have the ability to process ways or relations, they just accept nodes as input. However, more and more complex object are mapped as ways or even relations in order to get all their details into the database. Apply this option if you want to convert ways and relations to nodes and thereby make them available to applications which can only deal with nodes. For each way a node is created. The way's id is increased by 10^15 and taken as id for the new node. The node's longitude and latitude are set to the way's geographical center. Same applies to relations, however they get 2*10^15 as id offset. --add-bbox-tags This option adds a tag with a bounding box to each object. The tag will contain the border coordinates in this order: min Longitude, min Latitude, max Longitude , max Latitude. e.g.: --add-bboxarea-tags A tag for an estimated area value for the bbox is added to each way and each relation. The unit is square meters. For example: --add-bboxweight-tags This option will add the binary logarithm of the bbox area of each way and each relation. For example: --object-type-offset= If applying the --all-to-nodes option as explained above, you may adjust the id offset. For example: --object-type-offset=4000000000 By appending "+1" to the offset, the program will create ids in a sequence with step 1. This might be useful if the there is a subsequently running application which cannot process large id numbers. Example: --object-type-offset=1900000000+1 --drop-broken-refs Use this option if you need to delete references to nodes which have been excluded because lying outside the borders (mandatory for some applications, e.g. Map Composer, JOSM). --drop-author For most applications the author tags are not needed. If you specify this option, no author information will be written: no changeset, user or timestamp. --drop-version If you want to exclude not only the author information but also the version number, specify this option. --drop-nodes --drop-ways --drop-relations According to the combination of these parameters, no members of the referred section will be written. --diff Calculate difference between two files and create a new .osc or .o5c file. There must be TWO input files and borders cannot be applied. Both files must be sorted by object type and id. Created objects will appear in the output file as "modified", unless having version number 1. --diff-contents Similar to --diff, this option calculates differences between two OSM files. Here, to determine the differences complete OSM objects are consulted, not only the version numbers. Unfortunately, this option strictly requires both input files to have .o5m format. --subtract The output file will not contain any object which exists in one of the input files following this directive. For example: osmconvert input.o5m --subtract minus.o5m -o=output.o5m --emulate-osmosis --emulate-pbf2osm In case of .osm output format, the program will try to use the same data syntax as Osmosis, resp. pbf2osm. --fake-author If you have dropped author information (--drop-author) that data will be lost, of course. Some programs however require author information on input although they do not need that data. For this purpose, you can fake the author information. osmconvert will write changeset 1, timestamp 1970. --fake-version Same as --fake-author, but - if .osm xml is used as output format - only the version number will be written (version 1). This is useful if you want to inspect the data with JOSM. --fake-lonlat Some programs depend on getting longitude/latitude values, even when the object in question shall be deleted. With this option you can have osmconvert to fake these values: ... lat="0" lon="0" ... Note that this is for XML files only (.osc and .osh). -h Display a short parameter overview. --help Display this help. --merge-versions Some .osc files contain different versions of one object. Use this option to accept such duplicates on input. --out-osm Data will be written in .osm format. This is the default output format. --out-osc The OSM Change format will be used for output. Please note that OSM objects which are to be deleted will be represented by their ids only. --out-osh For every OSM object, the appropriate 'visible' tag will be added to meet 'full planet history' specification. --out-o5m The .o5m format will be used. This format has the same structure as the conventional .osm format, but the data are stored as binary numbers and are therefore much more compact than in .osm format. No packing is used, so you can pack .o5m files using every file packer you want, e.g. lzo, bz2, etc. --out-o5c This is the change file format of .o5m data format. All tags will not be performed as delete actions but converted into .o5c data format. --out-pbf For output, PBF format will be used. --out-csv A character separated list will be written to output. The default separator is Tab, the default columns are: type, id, name. You can change both by using the options --csv-separator= and --csv= --csv-headline Choose this option to print a headline to csv output. --csv-separator= You may change the default separator (Tab) to a different character or character sequence. For example: --csv-separator="; " --csv= If you want to have certain columns in your csv list, please specify their names as shown in this example: --csv="@id name ref description" There are a few special column names for header data: @otype (object type 0..2), @oname (object type name), @id @lon, @lat, @uid, @user --out-none This will be no standard output. This option is for testing purposes only. --timestamp= --timestamp=NOW If you want to set the OSM timestamp of your output file, supply it with this option. Date and time must be formatted according OSM date/time specifications. For example: --timestamp=2011-01-31T23:59:30Z You also can supply a relative time in seconds, e.g. 24h ago: --timestamp=NOW-86400 --out-timestamp With this option set, osmconvert prints just the time stamp of the input file, nothing else. --statistics This option activates a statistics counter. The program will print statistical data to stderr. --out-statistics Same as --statistics, but the statistical data will be written to standard output. -o= Standard output will be rerouted to the specified file. If no output format has been specified, the program will rely the file name extension. -t= If borders are to be applied or broken references to be eliminated, osmconvert creates and uses two temporary files. This parameter defines their name prefix. The default value is "osmconvert_tempfile". --parameter-file=FILE If you want to supply one ore more command line arguments by a parameter file, please use this option and specify the file name. Within the parameter file, parameters must be separated by empty lines. Line feeds inside a parameter will be converted to spaces. Lines starting with "// " will be treated as comments. -v --verbose With activated 'verbose' mode, some statistical data and diagnosis data will be displayed. If -v resp. --verbose is the first parameter in the line, osmconvert will display all input parameters. Examples ./osmconvert europe.pbf --drop-author >europe.osm ./osmconvert europe.pbf |gzip >europe.osm.gz bzcat europe.osm.bz2 |./osmconvert --out-pbf >europe.pbf ./osmconvert europe.pbf -B=ch.poly >switzerland.osm ./osmconvert switzerland.osm --out-o5m >switzerland.o5m ./osmconvert june_july.osc --out-o5c >june_july.o5c ./osmconvert june.o5m june_july.o5c.gz --out-o5m >july.o5m ./osmconvert sep.osm sep_oct.osc oct_nov.osc >nov.osm ./osmconvert northamerica.osm southamerica.osm >americas.osm Tuning To speed-up the process, the program uses some main memory for a hash table. By default, it uses 480 MB for storing a flag for every possible node, 90 for the way flags, and 30 relation flags. Every byte holds the flags for 8 ID numbers, i.e., in 480 MB the program can store 3840 million flags. As there are less than 1900 million IDs for nodes at present (July 2012), 240 MB would suffice. So, for example, you can decrease the hash sizes to e.g. 240, 30 and 2 MB using this option: --hash-memory=240-30-2 But keep in mind that the OSM database is continuously expanding. For this reason the program-own default value is higher than shown in the example, and it may be appropriate to increase it in the future. If you do not want to bother with the details, you can enter the amount of memory as a sum, and the program will divide it by itself. For example: --hash-memory=1000 These 1000 MiB will be split in three parts: 800 for nodes, 150 for ways, and 50 for relations. Because we are taking hashes, it is not necessary to provide all the suggested memory; the program will operate with less hash memory too. But, in this case, the border filter will be less effective, i.e., some ways and some relations will be left in the output file although they should have been excluded. The maximum value the program accepts for the hash size is 4000 MiB; If you exceed the maximum amount of memory available on your system, the program will try to reduce this amount and display a warning message. There is another temporary memory space which is used only for the conversion of ways and relations to nodes (option --all-to-nodes). This space is sufficient for up to 25 Mio. OSM objects, 400 MB of main memory are needed for this purpose, 800 MB if extended option --add-bbox-tags has been invoked. If this is not sufficient or if you want to save memory, you can configure the maximum number of OSM objects by yourself. For example: --max-objects=35000000 The number of references per object is limited to 100,000. This will be sufficient for all OSM files. If you are going to create your own OSM files by converting shapefiles or other files to OSM format, this might result in way objects with more than 100,000 nodes. For this reason you will need to increase the maximum accordingly. Example: --max-refs=400000 Limitations When extracting a geographical region (using -b or -B), the input file must contain the objects ordered by their type: first, all nodes, next, all ways, followed by all relations. Within each of these sections, the objects section must be sorted by their id in ascending order. Usual .osm, .osc, .o5m, o5c and .pbf files adhere to this condition. This means that you do not have to worry about this limitation. osmconvert will display an error message if this sequence is broken. If a polygon file for borders is supplied, the maximum number of polygon points is about 40,000. This program is for experimental use. Expect malfunctions and data loss. Do not use the program in productive or commercial systems. There is NO WARRANTY, to the extent permitted by law. Please send any bug reports to markus.weber@gmx.com Thanks for visiting me. Bye! Yours, Bert (To close this window, please press .) Danke fuer Ihren Besuch. Tschues! Schoene Gruesse - Bert (Zum Schließen dieses Fensters bitte die Eingabetaste druecken.) I am sorry, an error has occurred (see above). Es tut mir Leid, es ist ein Fehler aufgetreten (siehe oben). I just completed your new file with this name: Soeben habe ich Ihre neue Datei mit diesem Namen fertiggestellt: Now, please hang on - I am working for you. If the input file is very large, this will take several minutes. If you want to get acquainted with the much more powerful command line, this would have been your command: Einen Moment bitte - ich arbeite fuer Sie. Falls die Eingabe-Datei sehr gross ist, dauert das einige Minuten. Fall Sie sich mit der viel leistungsfaehigeren Kommandozeilen- eingabe vertraut machen wollen, das waere Ihr Kommando gewesen: Please choose the output file format: 1 .osm (standard XML format - results in very large files) 2 .o5m (binary format - allows fast) 3 .pbf (standard binary format - results in small files) Enter 1, 2 or 3: Bitte waehlen Sie das Format der Ausgabe-Datei: 1 .osm (Standard-XML-Format - ergibt sehr grosse Dateien) 2 .o5m (binaeres Format - recht schnell) 3 .pbf (binaeres Standard-Format - ergibt kleine Dateien) 1, 2 oder 3 eingeben: Please tell me the maximum latitude: Bitte nennen Sie mir den Maximum-Breitengrad: Please tell me the minimum latitude: Bitte nennen Sie mir den Minimum-Breitengrad: Please tell me the maximum longitude: Bitte nennen Sie mir den Maximum-Laengengrad: Please tell me the minimum longitude: Bitte nennen Sie mir den Minimum-Laengengrad: We need the coordinates of the border box. The unit is degree, just enter each number, e.g.: -35.75 Wir brauchen die Bereichs-Koordinaten in Grad, aber jeweils ohne Einheitenbezeichnung, also z.B.: 7,75 Sorry, the polygon file must have ".poly" as suffix. Sorry, die Polygon-Datei muss ".poly" als Endung haben. Please tell me the name of the polygon file: Bitte nennen Sie mir den Namen der Polygon-Datei: Sorry, the Changefile must have ".osc" or ".o5c" as suffix. Sorry, die Change-Datei muss ".osc" oder ".o5c" als Endung haben. Please tell me the name of the OSM Changefile: Bitte nennen Sie mir den Namen der OSM-Change-Datei: Please do not choose both, border box and border polygon. Bitte nicht beide Arten des Ausschneidens gleichzeitig waehlen. Sorry, I could not understand. Sorry, das habe ich nicht verstanden. What may I do with this file? 1 convert it to a different file format 2 use an OSM Changefile to update this file 3 use a border box to limit the geographical region 4 use a border polygon file to limit the geographical region 5 minimize file size by deleting author information 6 display statistics of the file Please enter the number of one or more functions you choose: Was soll ich mit dieser Datei tun? 1 in ein anderes Format umwandeln 2 sie per OSM-Change-Datei aktualisieren 3 per Laengen- und Breitengrad einen Bereich ausschneiden 4 mit einer Polygon-Datei einen Bereich ausschneiden 5 Autorinformationen loeschen und damit Dateigroesse minimieren 6 statistische Daten zu dieser Datei anzeigen Bitte waehlen Sie die Nummer(n) von einer oder mehreren Funktionen: Sorry, the file must have ".osm", ".o5m" or ".pbf" as suffix. Sorry, die Datei muss ".osm", ".o5m" oder ".pbf" als Endung haben. Sorry, I cannot find a file with this name in the current directory. Sorry, ich kann diese Datei im aktuellen Verzeichnis nicht finden. Please please tell me the name of the file you want to process: Bitte nennen Sie mir den Namen der Datei, die verarbeitet werden soll: Hi, I am osmconBert - just call me Bert. I will guide you through the basic functions of osmconvert. At first, please ensure to have the "osmconvert" file (resp. "osmconvert.exe" file if Windows) located in the same directory in which all your OSM data is stored. You may exit this program whenever you like. Just hold the key and press the key C. Hallo, ich bin osmconBert - nennen Sie mich einfach Bert. Ich werde Sie durch die Standardfunktionen von osmconvert leiten. Bitte stellen Sie zuerst sicher, dass sich die Programmdatei "osmconvert" (bzw. "osmconvert.exe" im Fall von Windows) im gleichen Verzeichnis befindet wie Ihre OSM-Dateien. Sie koennen das Programm jederzeit beenden. Halten Sie dazu die -Taste gedrueckt und druecken die Taste C. osmconvert 0.7Q Converts .osm, .o5m, .pbf, .osc, .osh files, applies changes of .osc, .o5c, .osh files and sets limiting borders. Use command line option -h to get a parameter overview, or --help to get detailed help. If you are familiar with the command line, press . If you do not know how to operate the command line, please enter "a" (press key E and hit ). osmconvert 0.7Q Konvertiert .osm-, .o5m-, .pbf-, .osc- und .osh-Dateien, spielt Updates von .osc-, .o5c- und .osh-Dateien ein und setzt geografische Grenzen. Die Kommandozeilenoption -h zeigt eine Parameteruebersicht, --help bringt eine detaillierte Hilfe (in Englisch). Wenn Sie mit der Kommandozeile vertraut sind, druecken Sie bitte . Falls Sie sich mit der Kommandozeile nicht auskennen, druecken Sie bitte "a" (Taste A und dann die Eingabetaste). -----------------------------------------------------------------        x        P        0                 66666666666666H666666666666666666666xH@X(((((p ~   @p$((`r\\"             # & ( + - 0 3 6 8 ; > A D G I L O R U X \ _ b e h k o r u y |  !! !!!!!#!(!-!1!6!;!@!D!I!N!S!X!]!b!g!l!q!v!{!!!!!!!!!!!!!!!!!!!!!!!!"" """ "&","2"9"?"E"L"R"Y"_"f"l"s"y""""""""""""""""""""####$#,#4#;#C#K#S#Z#b#j#r#z################$ $$$$$-$6$?$H$Q$Z$c$m$v$$$$$$$$$$$$$$$%%%&%0%:%D%O%Y%d%n%y%%%%%%%%%%%%%&&&*&5&A&M&X&d&p&|&&&&&&&&&&&'''('5'B'O'\'i'v''''''''''' (('(5(C(Q(_(n(|((((((((())).)>)M)])l)|))))))))) **.*?*O*`*q********* ++1+C+U+g+y++++++++,",5,I,\,o,,,,,,,,-$-8-M-b-w------- .".8.N.d.{......//1/I/`/x////// 0!0:0S0l0000001191S1n1111112+2G2b2~22222 3*3G3d333333464U4t44444515Q5r55555686Z6|66667)7M7p77778%8J8o88889-9S9z9999:@:h:::: ;6;`;;;; <6<b<<<<=A=n====(>W>>>>?H?y???@A@t@@@ACAxAAABOBBBB-CeCCCDKDDDD8EtEEE,FkFFF)GiGGG-HoHHH:I~II JOJJJ&KnKKLLLLL/M|MMNhNNOYOOOQPPPOQQQURRSbSSTvTT3UUUTVVW~WWJXXYYYYZZ3[[\\\h]]R^^A__6``/aa.bb3cc=ddMeedffghh8iifjjk8llxmnngoppiqrr~s4ttufv&wwxuy?z {{|}^~:ɂЎ /X.qZyYҥSۨjFl6ʻB-/X4#%<hs_9 2IV $).39>>DJ7PV]c klrz&Fl2lNI%6I\eqaj<8w_QQ*1m r+pc* )8ch#FTHUUU8VhVVWxXLY4Z\ZZZZ [<[d[[[d\\\]<]|]]](^d^^^(^t`:C bLbbb$chccef8h\K\S@B'd 33333i@33333f33333f@fffffVfffffV@K?;(VD8XdZ8[zR| lVrAB K<WAB K\|Y(AB N|Z5AB N ، o@Pp   oXoo܉.>N^n~΍ލ.>N^n~Ύގ.>N^n~Ώޏ.>N^n~ @x}Ƥ~osmconvert_tempfile5w`v|`v| \ r jGCC: (Ubuntu 4.4.3-4ubuntu5.1) 4.4.3.symtab.strtab.shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.commentTT#hh 1$HDo@@0N ppVPP^o܉ |koXX z     ، 0 ,P`ax xx, ^v 0%%,y R#Th@pP܉X   ،  x (5АKZh0t<`lБa"p # -0u7JЖ[]pi r| ~x   t0m` r ȱ%ı4>бI`QYpHe s}P#>رܱ874  0 @L Hq#^.8B|M IV^gupI~0II0@``Ա̱ 8# n/ $:ISİ_PhiNrN|Nz0hzzzr0055"0 x%m.`v|5ET|\ckguW)6pA5P[Pi tR$`Bq0H ,@ D x40HL P(@|$68 A ހKPUT_purX|\dPt<   @^z8 0N  #N0,"7"A"K"Z4e0sP 55555 5 5  {`, @p' 9 @C @5:L z`Y b Hm Dx y`    B  @ P P^    8 @ 4  < ( 4 (@ K $V ` 0f p z   ~ 0 0  \      . ` ? ̂Q Ăe X   &  (  & T T  H  < 4 L* ܂? Ԃ\ s `    | l t d  7 \P f D  P<   t p p l ̨Ȩ '4|B<I8P]ky@Ĩxt<|$1?xL_и nD}HH\4 ,0 '1;lFP$nZdxnT}XLPXPHd0l@`P#-t7pAKUX_TiDsL}LHD<8@h\d`X `$ , 4 < DNXblШv(PԨTب$, ܨ  h+5h?2Kd`qs 8rԬ$ ,(@n m8 p̸ ,;ܬFQج\@Xe v ܸ    (       ( ), 8 FX g v  `r0hjh d ` \ pl6mn pr#`tB0 sAyKxUА_lȸ w    :Г  rԸ ظ P#X 2q?ТPp_ n} tȹ Ĺ  JTT PgHl@!`,@?pMhX=c vE $<P  r   0      , 3;(QD_\m |xX|\4 `!d7hL<Z5ep|{@v|Dv|@oHv|Ф̤0Dq'1;EȤPĤ[fpp h Ьؤ,` (5@ԤKܤValvplȢ̢L &1CtQxZĢe $n 5 $4FW^i{   &3DVi(sH~   + `;2 D Q f q          !! )!Z9!S!d!v!!!!!į!!!"0r"L~"0"G"/R"]"o""""""""Z"c-"، crtstuff.c__CTOR_LIST____DTOR_LIST____JCR_LIST____do_global_dtors_auxcompleted.7021dtor_idx.7023frame_dummy__CTOR_END____FRAME_END____JCR_END____do_global_ctors_auxosmconvert.cuint32toaint64toapbf_uint32pbf_sint32pbf_uint64pbf_sint64hash_setihash__initializedhash__maxhash__memhash_getiborder__qsort_edgeborder_queryinsideborder__bx1nil.6196border__bx2border__by1border__by2border__edgeborder__edge_nborder_queryboxborder_activewrite_createsfix7opw__obj_disposepw__objppw__objpw__objeposi_getposi__mem_maskposi__mem_sizeposi__memposi__memeposi_xystrycmpborder__endborder__chainhash__endo5__endo5__bufcsv__endcsv__keycsv__valstr__endpstw__endpstw__mempstw__memeepstw__memecsv_addcsv__keyncsv__valnoo__strtodegdig.12773oo__strtimetosint64read_inputread_bufpread_buferead_infopcww__endcww__fdloglevelcww__filenamecwn__endcwn__fdcwn__filenamerr__endrr__fdrr__filenameposr__endposr__fdposr__filenameposi_setposi__memeeglobal_calccoordsposi__mem_incrementwrite_strwrite__bufpwrite__bufewrite__bufwrite_testmodewrite__fdwrite_errorrr__writerr__bufprr__bufeerr__writemoderr__bufposr__writeposr__bufpposr__bufeeposr__writemodeposr__bufwrite_memcww_readcww__bufpcww__bufecww__bufwrite_createtimestampoo_openoo__ifeoo__ifeeoo__ifglobal_subtractfirstrun.14038oo__ifpoo_ifnoo__endposi__endmsgn.10709msgn.10711msgn.10708csv_inifirstrun.7420csv_key_otypecsv_key_onamecsv_key_idcsv_key_longlobal_csvseparatorcsv__sep0csv__rep0csv_key_uidcsv_key_latmsgn.7428csv_key_usercww_rewindcww__writemodemsgn.11409pw__obj_closemsgn.10101pw__obj_add_idmsgn.9916pw__obj_openpw__objeemsgn.9802pw__bufeemsgn.9803pw__bufpw__bufepw__obj_limitmsgn.9851oo__dependencystagepw__obj_add_uint64msgn.10010pstw_storepstw__hashtabpstw__tabnpstw__tabmsgn.9682msgn.9681pw__obj_add_uint32msgn.9955pw__obj_add_sint64msgn.10037pw__obj_add_sint32msgn.9980pw__endmsgn.10364pw__compress_bufT.1892global_tempfilenameposr__bufemsgn.10880T.1893rr__bufeT.1894cwn__bufcwn__bufeecwn__bufecwn__bufpcwn__writemodemsgn.11259write_newfilewrite__filenamewrite__filename_tempwrite__filename_standardwrite__fd_standardo5_reseto5_ido5_lono5__bufpo5__bufr1o5__bufr0o5_lato5_cseto5_timeo5_refstw__tabistw__tabhashstw__hashtabstw_writestw__tabstw__tabnexto5__bufemsgn.11538msgn.11577stw__tabprevrs.11835write__endstr_readmsgn.11938pbf_jumpo5_writeT.1891pb_typepb__nodetagspb__nodetagsepb__relkeyepb__relvalepb__relkeypb__strmpb__relvalpb__strpb__waykeyepb__wayvalepb__waykeypb__wayvalmsgn.9374pb_idmsgn.9364msgn.9370msgn.9359oo__malloc_noo__malloc_passistantassistant_endtalk_section.16344lang.16341talk_lang1.16342talk_lang2.16343talk_intro.16345talk_hello.16346talk_input_file.16347input_file.16381talk_thanks.16350talk_function.16351function_only_statistics.16376talk_all_right.16352output_file.16393argv.16473border.16474talk_working.16365start_time.16377no_error.16395talk_error.16368talk_bye.16369talk_finished.16366talk_not_found.16348talk_input_file_suffix.16349talk_two_borders.16354changefile.16387talk_cannot_understand.16353talk_coordinates.16359talk_minlon.16360talk_minlat.16362talk_maxlon.16361talk_maxlat.16363talk_polygon_file.16357talk_polygon_file_suffix.16358talk_output_format.16364talk_changefile.16355talk_finished_file.16367talk_changefile_suffix.16356pb_inputnodeid.8227nodeide.8228waycomplete.8246relcomplete.8247groupp.8225groupe.8226msgn.8371msgn.8372nodelat.8241nodelate.8242nodelon.8243nodelone.8244pb_latpb_lonnodever.8229nodevere.8230nodetime.8231nodetimee.8232nodecset.8233nodecsete.8234nodeuid.8235nodeuide.8236nodeuser.8237nodeusere.8238pb_hisvermsgn.8377zbufp.8223zbufe.8224pb__stremsgn.8445zbuf.8222nodevis.8239nodevise.8240hisuser.8245global_complexwaysread__jumplockpb__relrefrolepb__relrefroleemsgn.8438msgn.8468msgn.8256global_dropversionmsgn.8281msgn.8293msgn.8294msgn.8331pb__waynodepb__waynodeemsgn.8311pb_hisvismsgn.8323msgn.8442msgn.8440msgn.8436bstre.8421msgn.8427pb__streemsgn.8332msgn.8446pb__relreftypepb__relreftypeemsgn.8359pb__relrefidpb__relrefidepb_hisuidpb_hiscsetpb_histimemsgn.8461msgn.8285pb_hisusermsgn.8458msgn.8473msgn.8462msgn.8466msgn.8425msgn.8424msgn.8456msgn.8457msgn.8412msgn.8413msgn.8464msgn.8465msgn.8469msgn.8467msgn.8268msgn.8271msgn.8273msgn.8277msgn.8279msgn.8275msgn.8459msgn.8463msgn.8300msgn.8251msgn.8252msgn.8337msgn.8258msgn.8329pb_filetimestampmsgn.8396pb_bby1pb_bbx1pb_bby2pb_bbx2msgn.8314msgn.8309msgn.8348msgn.8350msgn.8369msgn.8289msgn.8266msgn.8346msgn.8367msgn.8433msgn.8423msgn.8397msgn.8263msgn.8365msgn.8291msgn.8287msgn.8312msgn.8327msgn.8363msgn.8417msgn.8418msgn.8389pb_bbvalidmsgn.8403msgn.8249oo__gettyidoo__alreadyhavepbfobjectidoffset.13534global_diffoo__getformatmsgn.13709oo__bbvalidoo__bbx2oo__bby2oo__bbx1oo__bby1oo__whitespacenuloo__whitespaceoo__timestampglobal_mergeversionsglobal_timestamppbffilen.13704firstrun.11899msgn.13707msgn.11901msgn.13708pw__dataused_space.10181otype_old.10179pw__stmsgn.10185pw__dn_idpw__dn_latpw__dn_lonpw__dn_keysvalsmsgn.9880msgn.10069pw__dc_idpw__dc_lonpw__dc_latpw__dc_histimepw__dc_hiscsetpw__dc_hisuidpw__dc_hisuserpw__dn_hisverglobal_dropauthorpw__dn_hiscsetpw__dn_histimepw__dn_hisuidpw__dn_hisuserpw__dn_hismsgn.9881write_timestampwrite_sint64s.7245s1.7246s2.7247c.7248write_uint64write_uint32write_sfix7owrite_sfix7write_sfix6owrite_xmlstrallowedchar.6723pw_headermsgn.9933csv_writewo_way_closewo__formatpw__wayrel_keyspw__wayrel_valspw__wayrel_hispw__way_noderefswo_node_closewrite_xmlmnstrallowedchar.6881wo_flushwo__xmlclosetagwo__xmlshorttagwo_endglobal_outoscwo__lastactionendtag.12114wo_wayrel_keyvalwo_node_keyvalwo_addbboxtagsglobal_addbboxglobal_addbboxweightglobal_addbboxareacosrktab.5580s1.7216s2.7217c.7218wo_formatglobal_outoshwo__logactionwo_startglobal_outo5cfirstrun.10385msgn.11639msgn.11605global_csvheadlinefirstrun.9658msgn.10387wo__authorglobal_fakeversionglobal_fakeauthorwo_deleteglobal_fakelonlatoldtype.11683wo_nodestarttag.12113wo_noderefpw__dc_noderefwo_refpw__rel_rolespw__rel_refidspw__dc_refpw__rel_typeswo_relationwo_wayoo_mainglobal_dropbrokenrefsglobal_outo5mglobal_outpbfglobal_maxrefsglobal_completewayso5mtempfile.14083global_outtimestampglobal_outnoneglobal_statisticsglobal_outstatisticsoo__errorglobal_droprelationsglobal_emulatepbf2osmglobal_emulateosmosisglobal_emulateosmiumglobal_outcsvcww__bufeemsgn.13832msgn.13833oo__tyidoldoo__xmlheadtagoo__xmlkeyoo__letteroo__xmlvalmsgn.14252msgn.14253global_diffcontentsoo_sequencetypeoo_sequenceidglobal_dropwaysmsgn.6464oo__hexnumbermsgn.9483msgn.6504msgn.6505msgn.14254msgn.14255msgn.11284msgn.9526global_otypeoffset20global_otypeoffset15msgn.10910msgn.14155global_dropnodesglobal_otypeoffset05msgn.14338global_alltonodesglobal_addglobal_otypeoffset10msgn.14467global_otypeoffsetstepmsgn.14356msgn.14156msgn.14153msgn.11384msgn.14012msgn.9522siga.17060parafile.17056aa.17057msgn.17077msgn.17076msgn.17380msgn.17381outputfilename.17049global_outosmfirstrun.6593msgn.17385msgn.17383firstrun.11516msgn.17386msgn.17387global_maxobjectsfirstrun.5910nil.5984msgn.17369di.12772_GLOBAL_OFFSET_TABLE___dso_handle__init_array_end__init_array_start_DYNAMICdata_startsigemptyset@@GLIBC_2.0shorthelptext__umoddi3getpid@@GLIBC_2.0__cxa_atexit@@GLIBC_2.1.3__libc_csu_finimemcmp@@GLIBC_2.0qsort@@GLIBC_2.0_startinflateEndopen64@@GLIBC_2.1gzopen64__fprintf_chk@@GLIBC_2.3.4__gmon_start___Jv_RegisterClasses_fp_hw__isoc99_sscanf@@GLIBC_2.7__moddi3gzclosestrchr@@GLIBC_2.0_finideflatewrite@@GLIBC_2.0deflateInit_fgets@@GLIBC_2.0memset@@GLIBC_2.0fopen64@@GLIBC_2.1__udivdi3__libc_start_main@@GLIBC_2.0dependencystagestrrchr@@GLIBC_2.0gzseek64read@@GLIBC_2.0timegm@@GLIBC_2.0perror@@GLIBC_2.0gmtime_r@@GLIBC_2.0_IO_stdin_usedinflatefree@@GLIBC_2.0atexitaccess@@GLIBC_2.0__data_startsigaction@@GLIBC_2.0deflateEnd__ctype_b_loc@@GLIBC_2.3gzdopenfclose@@GLIBC_2.1stderr@@GLIBC_2.0memcpy@@GLIBC_2.0strlen@@GLIBC_2.0unlink@@GLIBC_2.0helptextsetlocale@@GLIBC_2.0strcpy@@GLIBC_2.0__DTOR_END____libc_csu_init__strcpy_chk@@GLIBC_2.3.4close@@GLIBC_2.0strstr@@GLIBC_2.0time@@GLIBC_2.0__bss_startmalloc@@GLIBC_2.0__stack_chk_fail@@GLIBC_2.4stdin@@GLIBC_2.0zlibCompileFlags@@ZLIB_1.2.0.2inflateInit_memmove@@GLIBC_2.0__divdi3_endstdout@@GLIBC_2.0__rawmemchr@@GLIBC_2.1sigcatcherstr__infopstrspn@@GLIBC_2.0__sprintf_chk@@GLIBC_2.3.4gzread_edatastrcspn@@GLIBC_2.0lseek64@@GLIBC_2.1strcmp@@GLIBC_2.0exit@@GLIBC_2.0__i686.get_pc_thunk.bxmain_init